PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03031.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 316aa    MW: 35894.2 Da    PI: 5.9097
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03031.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-182673148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+W+ eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Zmw_sc03031.1.g00080.1.sm.mkhc 26 RGPWSVEEDLLLVNYIAAHGEGQWNALARCAGLKRTGKSCRLRWLNYL 73
                                    89********************************************97 PP

2Myb_DNA-binding53.55.6e-1779122146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     rg++T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Zmw_sc03031.1.g00080.1.sm.mkhc  79 RGNFTAQEQLLILELHSRWGNR-WSRIAQHLP-GRTDNEIKNYWRT 122
                                     89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4892173IPR017930Myb domain
SuperFamilySSF466891.35E-3024120IPR009057Homeodomain-like
SMARTSM007171.5E-152575IPR001005SANT/Myb domain
PfamPF002491.4E-162673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-222780IPR009057Homeodomain-like
CDDcd001671.32E-112873No hitNo description
PROSITE profilePS5129423.66574128IPR017930Myb domain
SMARTSM007173.6E-1578126IPR001005SANT/Myb domain
PfamPF002497.3E-1679122IPR001005SANT/Myb domain
CDDcd001672.23E-1181122No hitNo description
Gene3DG3DSA:1.10.10.608.2E-2481126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKMMAVREQR EMSSEDESQV SGDLRRGPWS VEEDLLLVNY IAAHGEGQWN ALARCAGLKR  60
TGKSCRLRWL NYLRPDLRRG NFTAQEQLLI LELHSRWGNR WSRIAQHLPG RTDNEIKNYW  120
RTRVQKHARQ LNCDVNSQQF RDLVRYLWIP RLLERMHLSG SSSPPDVTPP SQLQQFHHFN  180
EVELSYTTAA SSSSSVSTDG MQQQPPLVSQ PEMVSAAEGS YWSTCTDNDN NKNDSMKKSS  240
MSLCADTWCQ PPNASTTECY NPAQYLGASE TCWSSVVPAD PFSTGVYAAD MAPFLPDLGE  300
TMWGADDLWY TQIMGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24231264106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958743.11e-115PREDICTED: myb-related protein 330-like
TrEMBLK3ZVF31e-115K3ZVF3_SETIT; Uncharacterized protein
STRINGSi030584m1e-115(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330